SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000004822 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000004822
Domain Number 1 Region: 44-101
Classification Level Classification E-value
Superfamily Kringle-like 1.54e-17
Family Fibronectin type II module 0.0045
Further Details:      
 
Domain Number 2 Region: 13-55
Classification Level Classification E-value
Superfamily Kringle-like 0.000000000000131
Family Fibronectin type II module 0.0031
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000004822   Gene: ENSOCUG00000005554   Transcript: ENSOCUT00000005555
Sequence length 105
Comment pep:novel scaffold:OryCun2.0:GL019089:102799:104357:1 gene:ENSOCUG00000005554 transcript:ENSOCUT00000005555 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VHPPSFPDIPSTPCIFPFTYADVMHYNCISVHSDFDWCSLDSQFQGRWRYCLSNDPPQCT
FPFFFKKKVFYQCTKEDYILDRSWCSLTKNYNKDKKWKQCSPRNF
Download sequence
Identical sequences G1SP69
ENSOCUP00000004822 ENSOCUP00000004822 9986.ENSOCUP00000004822

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]