SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000004836 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000004836
Domain Number 1 Region: 10-255
Classification Level Classification E-value
Superfamily Carbonic anhydrase 1.83e-91
Family Carbonic anhydrase 0.000000012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000004836   Gene: ENSOCUG00000005571   Transcript: ENSOCUT00000005569
Sequence length 276
Comment pep:known_by_projection chromosome:OryCun2.0:X:1537429:1638036:1 gene:ENSOCUG00000005571 transcript:ENSOCUT00000005569 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
QTWNQALHPLWESVDLVPAGDRQSPINIRWRDSVYDPGLKPLTISYDPATCLHIWNNGYS
FLVEFEDSTDKSVIEGGPLDHNYRLKQFHFHWGAIDAWGSEHTVDSKCYPAELHLVHWNA
VKFESFEDAAVEENGLAVIGVFLKLGKHHKELQKLVETFPSIKHKDTLVEFGSFDPSCLM
PTCPDYWTYSGSLTTPPLSESVTWIIKKQPVEVDHDQLEQFRTLLFTSEGEKEKRMVDNF
RPLQPLMNRTVRSSFRHDYVLNRQAIPKPETSQVTP
Download sequence
Identical sequences G1SP83
ENSOCUP00000004836

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]