SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000004845 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000004845
Domain Number 1 Region: 5-361
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 4.04e-64
Family L-arabinose binding protein-like 0.0047
Further Details:      
 
Domain Number 2 Region: 382-495,614-753
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 3.8e-63
Family Phosphate binding protein-like 0.00000000282
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000004845
Domain Number - Region: 517-609
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000785
Family Voltage-gated potassium channels 0.018
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000004845   Gene: ENSOCUG00000005581   Transcript: ENSOCUT00000005581
Sequence length 867
Comment pep:known_by_projection scaffold:OryCun2.0:GL018704:1526865:1612014:1 gene:ENSOCUG00000005581 transcript:ENSOCUT00000005581 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNAEEHAFRFSANIINRNRTLLPNTTLTYDIQRIHFHDSFEATKKACDQLALGVVAIFGP
SQGSCTNAVQSICNALEVPHIQLRWKHHPLDNKDTFYVNLYPDYASLSHAILDLVQYLKW
RSATVVYDDSTGLIRLQELIMAPSRYNIRLKIRQLPIDSDDSRPLLKEMKRGREFRIIFD
CSHTMAVQILKQAMAMGMMTEYYHFIFTTLDLYALDLEPYRYSGVNLTGFRILNVDNPHV
SAIVEKWSMERLQAAPRVESGLLDGVMMTDAALLYDAVHIVSVCYQRAPQMTVNSLQCHR
HKAWRFGGRFMNFIKEAQWEGLTGRIVFNKTSGLRTDFDLDIISLKEDGLEKVGVWSPAD
GLNITEVAKGRGPNVTDSLTNRSLIVTTVLEEPFVMFRKSDRTLYGNDRFEGYCIDLLKE
LSHILGFSYEIRLVEDGKYGAQDDKGQWNGMIKELIDHKADLAVAPLTITHVREKAIDFS
KPFMTLGVSILYRKPNGTNPSVFSFLNPLSPDIWMYVLLAYLGVSCVLFVIARFSPYEWY
DAHPCNPGSEVVENNFTLLNSFWFGMGSLMQQGSELMPKALSTRIIGGIWWFFTLIIISS
YTANLAAFLTVERMESPIDSADDLAKQTKIEYGAVKDGATMTFFKKSKISTFEKMWAFMS
SKPSALVKNNEEGIQRTLTADYALLMESTTIEYVTQRNCNLTQIGGLIDSKGYGIGTPMG
SPYRDKITIAILQLQEEDKLHVMKEKWWRGSGCPEEDSKEASALGIQKIGGIFIVLAAGL
VLSVLVAVGEFVYKLRKTAEREQRSFCSTVADEIRFSLTCQRRVKHKPQPPMMVKTDAVI
NMHTFNDRRLPGKDTMTCSSSLTPVFP
Download sequence
Identical sequences G1SP91
ENSOCUP00000004845

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]