SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000005144 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000005144
Domain Number 1 Region: 41-338
Classification Level Classification E-value
Superfamily Inorganic pyrophosphatase 1.44e-108
Family Inorganic pyrophosphatase 0.0000000585
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000005144   Gene: ENSOCUG00000005941   Transcript: ENSOCUT00000005942
Sequence length 341
Comment pep:novel chromosome:OryCun2.0:15:44161098:44267983:1 gene:ENSOCUG00000005941 transcript:ENSOCUT00000005942 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRALLALLRTGRGWRAGSPVAAHPPAGARARSGPLRAMALYHTEERGRPHSEDYRLFFKN
VAGHYISPFHDIPLKVESKEENGIPTKKARNDEYENLFNMVVEVPRWTNAKMEIATKEPL
NPIKQDVKHGKLRYVANIFPHKGYIWNYGALPQTWEDPHQTDESTNCCGDNDPIDVCEIG
SKVLTRGEVVHVKILGILALIDEGETDWKLIAINANDPEASKFDDIDDVKKFKPGYLEAT
LNWFKFYKVPDGKPENQFAFNGEFRNKAFALEVIKSTHDHWKALLMKKCDGGAINCTNVQ
VCDSPFLCTQEEARSFVESKLSSSQNNENDEEEQIWHFLGK
Download sequence
Identical sequences G1SPZ9
ENSOCUP00000005144 XP_008265756.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]