SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000005212 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000005212
Domain Number 1 Region: 32-262
Classification Level Classification E-value
Superfamily Heme oxygenase-like 9.2e-74
Family Eukaryotic type heme oxygenase 0.00000045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000005212   Gene: ENSOCUG00000006018   Transcript: ENSOCUT00000006018
Sequence length 316
Comment pep:known scaffold:OryCun2.0:GL018787:716883:758644:1 gene:ENSOCUG00000006018 transcript:ENSOCUT00000006018 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSAEVETSEGVDEPEEKNFGENHIRSPNRMADLSELLKEGTKEAHDRAENTKFVKDFLKG
NIKKEIFKLATTALYFTYSALEEEMDRNKDHPAFAPLYFPMELHRKEALTKDMEYFFGEN
WEEQVQCSEAAQKYVERIHYIGQNEPELLVAHAYTRYMGDLSGGQVLKKVAQRALKLPST
GEGTQFYLFENVDNAQQFKQFYRARMNALDLNLKTKERIVEEANKAFEYNMQIFSELDQA
GSAPASETVEDRIPVHDGKGDVRKCPYYAAGQVNGALEGSSCPFRAAMAVLRKPSLQLVL
AAAVALAAGLLAWYYM
Download sequence
Identical sequences G1SQ54
9986.ENSOCUP00000005212 ENSOCUP00000005212 ENSOCUP00000005212

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]