SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000005402 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000005402
Domain Number 1 Region: 201-338
Classification Level Classification E-value
Superfamily TPR-like 1.46e-27
Family Tetratricopeptide repeat (TPR) 0.0026
Further Details:      
 
Domain Number 2 Region: 95-181
Classification Level Classification E-value
Superfamily FKBP-like 0.0000000206
Family FKBP immunophilin/proline isomerase 0.0046
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000005402   Gene: ENSOCUG00000006245   Transcript: ENSOCUT00000006242
Sequence length 349
Comment pep:known_by_projection chromosome:OryCun2.0:12:20913048:20914097:-1 gene:ENSOCUG00000006245 transcript:ENSOCUT00000006242 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
METPPVLPVGEKDASPPQQPWEQDSRGNLASATQIRLQPPEPPTQSLQLGLSPDPASRRL
EHPRGTPTQLAGPEGGSDTSRGSPSEAPEPLRAPDLWRCPDGSFVKKIITRGRGLDKPKL
GSRCRVLACGFPLGSGPPEGWTELTIGMGPWREEAWGELVEKCLESMCQGEEAELRLPGH
SGPPAGLTLASFTPGRDSWQLQISEKEALAREERARGTELFRAGNPEGAARCYGRALRLL
LTLPPPGPPERTVLHANLAACQLLLGQPQLAVQSCNRVLEREPGHLKALYRRGVAQAALG
NLEKASADLKKVLAVDPKNRAAHEELEKVANREKKQKAGLAQGLRKMFG
Download sequence
Identical sequences G1SQL8
XP_002714344.1.1745 XP_008260836.1.1745 ENSOCUP00000005402 9986.ENSOCUP00000005402 ENSOCUP00000005402

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]