SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000005576 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000005576
Domain Number 1 Region: 67-201
Classification Level Classification E-value
Superfamily Band 7/SPFH domain 5.62e-40
Family Band 7/SPFH domain 0.0027
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000005576
Domain Number - Region: 208-320
Classification Level Classification E-value
Superfamily ALDH-like 0.0392
Family ALDH-like 0.011
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000005576   Gene: ENSOCUG00000006451   Transcript: ENSOCUT00000006450
Sequence length 356
Comment pep:known_by_projection chromosome:OryCun2.0:1:18780389:18783384:1 gene:ENSOCUG00000006451 transcript:ENSOCUT00000006450 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLARAARGTGALLLRGSVQASVRAPHRASSGLPRNTVVLFVPQQEAWVVERMGRFHRILE
PGLNILIPVLDRIRYVQSLKEIVINVPEQSAVTLDNVTLQIDGVLYLRIMDPYKASYGVE
DPEYAVTQLAQTTMRSELGKLSLDKVFRERESLNANIVDAINQAADCWGIRCLRYEIKDI
HVPPRVKESMQMQVEAERRKRATVLESEGTRESAINVAEGKKQAQILASEAEKAEQINQA
AGEASAVLAKAKAKAEAIRILAAALTQHNGDAAASLTVAEQYVNAFSKLAKDSNTILLPS
NPGDVTSMVAQAMGVYGALTKAPGSGAQDSVSRGSGRDVQGTDASLDVELDRVKLS
Download sequence
Identical sequences G1SR13
ENSOCUP00000005576 XP_002708054.1.1745 ENSOCUP00000005576 9986.ENSOCUP00000005576

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]