SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000005764 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000005764
Domain Number 1 Region: 61-333
Classification Level Classification E-value
Superfamily Radical SAM enzymes 1.44e-72
Family MoCo biosynthesis proteins 0.00000473
Further Details:      
 
Domain Number 2 Region: 478-622
Classification Level Classification E-value
Superfamily Molybdenum cofactor biosynthesis protein C, MoaC 1.44e-52
Family Molybdenum cofactor biosynthesis protein C, MoaC 0.0000145
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000005764   Gene: ENSOCUG00000006667   Transcript: ENSOCUT00000006667
Sequence length 625
Comment pep:known chromosome:OryCun2.0:12:29777629:29803452:-1 gene:ENSOCUG00000006667 transcript:ENSOCUT00000006667 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAARPVARMVRRLLGPGTRSCSSGGPVSQPRPGEPSQPATEVLSRRRQFLREHAAPFSAF
LTDRFGRRHSYLRISLTEKCNLRCQYCMPEEGVSLTPKADLLTTEEILTLARLFVKEGVD
KIRLTGGEPLIRPDVVDIVARLHRLEGLRTIGVTTNGINLARLLPQLQKAGLSAINVSLD
TLVPAKFEFIVRRKGFHKVMEGIHKAIELGYSPVKVNCVVMRGLNEDELLDFVALTKGLP
LDVRFIEYMPFDGNKWNFKKMVSYKEMLDTIQQQWPDLEKLPEEESSTAKAFRIPGFQGQ
VSFITSMSEHFCGTCNRLRITADGNLKSNLQGNIRSRLLDGWKKTHSTQPFIGAGRGTRK
EPNPGMFNISQMKNRPMILIDLLLLTLQGSPPASPSVFSWAPLRVQGLRPRMSFSNPTAA
LWKGSRVPQAAAVAQQWWGSGCPQRHHSSCVHSDTDSKCLSSGSLPASDQLTHVDSEGRA
AMVDVGRKPDTERVAVASALVLLGPVAFELVRQNQLKKGDALMVAQLAGIQAAKLTSQLI
PLCHQVALSHVQVQLELDSTRHAVAIQATCRARGPTGVEMEALTSASVAALSLYDMCKAV
SRDIVVREVKLISKTGGQRGDFHRA
Download sequence
Identical sequences G1SRG7
ENSOCUP00000005764 ENSOCUP00000005764 9986.ENSOCUP00000005764

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]