SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000005961 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000005961
Domain Number 1 Region: 44-252
Classification Level Classification E-value
Superfamily PHP domain-like 1.92e-43
Family RNase P subunit p30 0.012
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000005961   Gene: ENSOCUG00000006896   Transcript: ENSOCUT00000006894
Sequence length 291
Comment pep:known_by_projection chromosome:OryCun2.0:18:38874608:38905005:1 gene:ENSOCUG00000006896 transcript:ENSOCUT00000006894 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPRGGGLGGCAEECACGVSWDCSMAVFADLDLRAGSDLKSLRGLVETAAHLGYSVVAINH
VVDFKEKKQEIEKPIAVSELFTTLPIVQGKSRPIKILTRVTIVVSDPSHCNVLRATSSRV
RLYDIVAVFPKTEKLFHVACTQLDVDLVCVTVTEKLPFYFRRPPISVAIDRDLSFELVYS
PAIKDSTVRRYTISNALNLMQICRGKNVIISSAAERPLEIRGPYDVANLGLLFGLTENTA
KAAVSTNCRAALLHGETRKTAFGIISTVKKPRPSEGDDDSLPACKKAKCEG
Download sequence
Identical sequences G1SRX9
ENSOCUP00000005961

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]