SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000006042 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000006042
Domain Number 1 Region: 401-576,609-705
Classification Level Classification E-value
Superfamily Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 1.57e-56
Family Second domain of Mu2 adaptin subunit (ap50) of ap2 adaptor 0.00046
Further Details:      
 
Domain Number 2 Region: 1120-1176
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 9.16e-21
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.00011
Further Details:      
 
Domain Number 3 Region: 705-748
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 0.000000000000068
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.0006
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000006042   Gene: ENSOCUG00000006982   Transcript: ENSOCUT00000006984
Sequence length 1176
Comment pep:known chromosome:OryCun2.0:2:137700945:137802514:-1 gene:ENSOCUG00000006982 transcript:ENSOCUT00000006984 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCSMNPGNWVTFDDDLAFQSSQKPKSLPLESQGVCRPNGLKLNLSGPKEFPSGASSTSST
PLSSPIVDFYFSPGPPSNSPLSTPTKDFPGFPGIPKAGTHVLYPIPESSSNSPLTTGSSL
SPTKPTCVSHAFLPSEHSDAHPAPRGGLTNETSPHQAESQECQSDAPQFRYSHEDCAFSS
PFWKDEGGAPQVSLDLPGSRKTFSSRDKEMPIDQKSLNKCSLNYICEKLEHLQSAENQES
LGDLSVRCLNAEDAASSFVPRSLFRSQPKAGWAFMLRIPEKKNVMSSRQWGPIYLKVLPG
GILQMYYEKGLERPFRELQLDPQCRLSEPKVESFSVAGKIHTVKIEHVSYTEKRKYHSKT
EVVHEPDVEQMLKLGTTDYQDFLAFLTTVEEELTKLPALPKPKKSYEEQELTLEVVDNFW
GKVTKGEGKLVESTVITQIGCLCFVNGNADCFLTLNDLELQKRDESYFEKNPEKRGIDIL
EYHFHKCVKVQEFEQSRIIRFVPLDACRFELMRFKTLYNGDDLPFSVKSVVVVQGAYVEL
QAFINMAPLAQRSSPAGSLMSCDNVMIHFPVPSQWIKALWTMNLQRQKSLKAKMNRRACL
GSLHEPESEPVIQVTVGSAKYESAYRAVVWKIDRLPDKNSSPDHPHCLSYKLELGSDQEI
PSDWYPFATVQFVMLDTCASRTEVRSLGVESDVQPQKHVHQRACYNVQPKLYRSVIEDVI
EGVRELFAEEGIEEQVLKDLKQLWETKVLQSKATEDFFRNRVHAPVFTLQLPQGLHQTLQ
STASLVIPTGRTLPSFTAAELGTSNCNANLTFPGYPIHVPAGVTLQTASGHLYKVSVPIV
VTQTSGRTGVLQHPIQQVLQPGQPSVIPTSVPPLSPCTLQATTENSQRVETVLQQPTLLC
SAPGRRKHLETGTSDVVVPPATERTVTSEALRSQQGSSLCSHLPGGAFPSHVLETDSTVD
SGLRVSTSMTQNLRGGPLSTSPQGASRQHGDAQLHILKNKMYGCDSAKQPRNTEEPCSLP
VSEKESNSQVDLNIHKTDDDTNEIIQIDGTGDASSNEELGGSRDVDESEFLGIIDAGDLK
VLEEEADSISNEGSTANSSDNEDSQIGTVEEDPLNSGDDVSEQDVPDLFDTDNVIVCQYD
KIHRSKNKWKFYLKDGVMCFGGRDYVFAKAIGDAEW
Download sequence
Identical sequences G1SS54
ENSOCUP00000006042 9986.ENSOCUP00000006042 ENSOCUP00000006042

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]