SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000006139 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000006139
Domain Number 1 Region: 209-309
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 1.95e-25
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.0011
Further Details:      
 
Domain Number 2 Region: 30-84,112-127
Classification Level Classification E-value
Superfamily PYP-like sensor domain (PAS domain) 0.0000000000000517
Family Hypoxia-inducible factor Hif2a, C-terminal domain 0.086
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000006139   Gene: ENSOCUG00000007097   Transcript: ENSOCUT00000007099
Sequence length 474
Comment pep:known_by_projection chromosome:OryCun2.0:8:12856022:12890836:-1 gene:ENSOCUG00000007097 transcript:ENSOCUT00000007099 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GLTNSYVDGNYRPSFIQDSELRHLILQTAEGFLFVVGCERGKILFVSKSVSKILNYDQAT
LTGQSLFDFLHPKDVAKVKEQLSSPDVSPRDKLIDAKRKVNYIKIFHTRRTRVCSGSRRS
FFCRMRSYKCAIKEEHDPVPKPKRKDHRRFCTIHCTGYLRTWPPDISGMEEERDPKEHRS
HFTCLVAVGRLHPCAVPQSSAGVKVRPTEFVTRFAMNGKFVYVDQRVTAVLGYLPQELLG
TSCYEYFHQDDHGDLTDKHRAVLQSKEKIFTDPYKFRGKDGSFVTLKSQWFSFTNPWTKE
LEYIVSVNTLVLGCRDTGEASLFPCSCQASEESCRQSGVGVPGRSPGTVPGACSIGTDTA
NEDLGVHRLQSASSLDDSSPADAMRERHAVHCGDVSEKEFCPLSPGGSGLQAARHHRHMA
AVHSQEPLLSDGAQLDFDSLYDNDDTTVAAFMNYLEAEGGLGDSGDFSDIQWTL
Download sequence
Identical sequences G1SSD2
ENSOCUP00000006139 ENSOCUP00000006139 9986.ENSOCUP00000006139

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]