SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000006154 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000006154
Domain Number 1 Region: 1-50
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 0.0000693
Family F1F0 ATP synthase subunit C 0.022
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000006154
Domain Number - Region: 58-86
Classification Level Classification E-value
Superfamily F1F0 ATP synthase subunit C 0.000589
Family F1F0 ATP synthase subunit C 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000006154   Gene: ENSOCUG00000007121   Transcript: ENSOCUT00000007117
Sequence length 86
Comment pep:known_by_projection scaffold:OryCun2.0:GL018968:236626:239846:1 gene:ENSOCUG00000007121 transcript:ENSOCUT00000007117 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LGAAYGTAKSGTGIAAMSVMRPEMIMKSIIPVVMAGIIAIYGLVVAVLIANSLNDGISLY
RSFLQLGAGLSVGLSGLAAGFAIGIV
Download sequence
Identical sequences G1SSE2
ENSOCUP00000006154

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]