SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000006516 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000006516
Domain Number 1 Region: 86-223
Classification Level Classification E-value
Superfamily FKBP-like 2.36e-37
Family FKBP immunophilin/proline isomerase 0.000000929
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000006516
Domain Number - Region: 25-88
Classification Level Classification E-value
Superfamily GHMP Kinase, C-terminal domain 0.023
Family Mevalonate 5-diphosphate decarboxylase 0.0098
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000006516   Gene: ENSOCUG00000007535   Transcript: ENSOCUT00000007534
Sequence length 224
Comment pep:known chromosome:OryCun2.0:17:64490821:64503890:-1 gene:ENSOCUG00000007535 transcript:ENSOCUT00000007534 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAAAVPQRAWTVEQLRSEQLPKKDIIKFLQDHGSDSFLAEHKLLGNIKNVAKTANKDHLV
TAYNHLFETKRFKGSENVTKVSEQVKNVKLNEDKPKETKSEETPDEGPPKYTKSVLKKGD
KTNFPKKGDVVHCWYTGTLQDGTVFDTNIQTSSKKKKNAKPLSFKVGVGKVIRGWDEALL
TMSKGEKARLEIEPEWAYGKKGQPDAKIPPNAKLIFEVELVDID
Download sequence
Identical sequences O46638
9986.ENSOCUP00000006516 XP_002718212.1.1745 ENSOCUP00000006516 ENSOCUP00000006516

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]