SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000006587 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000006587
Domain Number 1 Region: 356-693
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 2.88e-134
Family Transferrin 0.00000000000257
Further Details:      
 
Domain Number 2 Region: 23-346
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 7.65e-123
Family Transferrin 0.0000000000052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000006587   Gene: ENSOCUG00000007617   Transcript: ENSOCUT00000007617
Sequence length 695
Comment pep:known chromosome:OryCun2.0:14:27729568:27759195:1 gene:ENSOCUG00000007617 transcript:ENSOCUT00000007617 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRLAAGALLACAALGLCLAVTEKTVRWCAVNDHEASKCANFRDSMKKVLPEDGPRIICVK
KASYLDCIKAIAAHEADAVTLDAGLVHEAGLTPNNLKPVVAEFYGSKENPKTFYYAVALV
KKGSNFQLNELQGKKSCHTGLGRSAGWNIPIGLLYCDLPEPRKPLEKAVASFFSGSCVPC
ADGADFPQLCQLCPGCGCSSVQPYFGYSGAFKCLKDGLGDVAFVKQETIFENLPSKDERD
QYELLCLDNTRKPVDEYEQCHLARVPSHAVVARSVDGKEDLIWELLNQAQEHFGKDKSGD
FQLFSSPHGKNLLFKDSAYGFFKVPPRMDANLYLGYEYVTAVRNLREGICPDPLQDECKA
VKWCALSHHERLKCDEWSVTSGGLIECESAETPEDCIAKIMNGEADAMSLDGGYVYIAGQ
CGLVPVLAENYESTDCKKAPEEGYLSVAVVKKSNPDINWNNLEGKKSCHTAVDRTAGWNI
PMGLLYNRINHCRFDEFFRQGCAPGSQKNSSLCELCIGPSVCAPNNREGYYGYTGAFRCL
VEKGDVAFVKSQTVLQNTGGRNSEPWAKDLKEEDFELLCLDGTRKPVSEAHNCHLAKAPN
HAVVSRKDKAACVKQKLLDLQVEYGNTVADCSSKFCMFHSKTKDLLFRDDTKCLVDLRGK
NTYEKYLGADYIKAVSNLRKCSTSRLLEACTFHKH
Download sequence
Identical sequences G1STF7
9986.ENSOCUP00000006587 ENSOCUP00000006587 ENSOCUP00000006587

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]