SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000006671 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000006671
Domain Number 1 Region: 114-285
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase C-terminal domain-like 6.28e-51
Family NadC C-terminal domain-like 0.0000263
Further Details:      
 
Domain Number 2 Region: 10-113
Classification Level Classification E-value
Superfamily Nicotinate/Quinolinate PRTase N-terminal domain-like 4.32e-25
Family NadC N-terminal domain-like 0.0025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000006671   Gene: ENSOCUG00000007720   Transcript: ENSOCUT00000007718
Sequence length 299
Comment pep:novel scaffold:OryCun2.0:GL018752:1882494:1895608:1 gene:ENSOCUG00000007720 transcript:ENSOCUT00000007718 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDAEGLALLLPPPTLAALASSWLQEDCPGLHVTALVTGAAPSQAALWAKSPGVLAGRPFF
DAIFAQLGCQVSWLLPEGSKLVPVTKVAEVRGPAHRLLLGERVALNTLARCSGIASAAAE
AVRVARGTGWTGHVAGTRKTTPGFRLVEKYGLLVGGAAPHRYDLGGLVMVKDNHVVAAGD
VEQAVRGARRAADFALKVEVECSSLQEAVRAARAGADLVLLDNFQPEELHPTAAALKAQF
PSLVVEASGGVTLGNLPQFCGPHVDVISLGMLTQAAPALDFSLKLFAEGTTPVPHARRS
Download sequence
Identical sequences G1STM6
ENSOCUP00000006671 XP_002721787.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]