SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000006703 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000006703
Domain Number 1 Region: 1346-1484
Classification Level Classification E-value
Superfamily PRC-barrel domain 1.1e-62
Family RIKEN cDNA 2310057j16 protein (KIAA1543) 0.00000151
Further Details:      
 
Domain Number 2 Region: 235-335
Classification Level Classification E-value
Superfamily Calponin-homology domain, CH-domain 0.00000000000576
Family Calponin-homology domain, CH-domain 0.0051
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000006703   Gene: ENSOCUG00000007754   Transcript: ENSOCUT00000007759
Sequence length 1490
Comment pep:known_by_projection chromosome:OryCun2.0:16:70524143:70640962:-1 gene:ENSOCUG00000007754 transcript:ENSOCUT00000007759 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDAADPRELKKTFIVPAIKPFDHYDFSRAKIACNLAWLVAKAFGTENVPEELQEPFYTD
QYDQEHIKPPVVNLLLSAELYCRAGSLILKSDAAKPLLGHDAVMQALAQKGLYVTDQEKL
VTERDLHKKPIQMSAHLAMIDTLMMAYTVEMVSIEKVIACAQQYSTFFQATDLPYDIEDA
VMYWINKVNEHLKDIMEQEQKLKEHHTIEAPGGQKSPSKWFWKLVPARYRKEQTLLKQLP
CIPLVENLLKDGTDGCALAALIHFYCPSVVRLEDICLKETMSLADSLYNLQLIQEFCQEY
LNQCCHFTLEDMLYAASSIKSNYLVFMAELFWWFEVVKPSFVQPRVFHPQGAFILAEPVT
VPVLNAAKRNVLDGSCSSDFTSSGEGATYTQSHHLPSRYSRPHAHSSASGGIRRSSSMSY
VDGFIGTWPKEKRSSVHGVSFDISFDKEDSVRRPTPTRGITRSISNEGLTLNNSRTSKHI
RKNLSFKPVNGEEEAESIEEEFNVESHSDLRSYVPLNTNELNSNENIHYRLPNGDLQNRI
LLDEFGNQIETPSIEEALQIIHDTEKSPRTPQPDQIANGFFLHSQEMSILNSNIRLNQSS
PDNVTDTKGALSPITDNTEVDTGIHVPSEDIPETMDEDSSLRDYTVSLDSDMDDASKFLQ
DYDLRTSNPREALSPCPSTVSTKSQPGSSASSSSGVKMTSFAEQKFKKLNHADGKSSGSS
SQKTTPEGSELNIPHVVAWAQIPEETGLPQGRDTTQLLASEMVHLRMKLEEKRRAIEAQK
KKMEAAFTKQRQKMGRTAFLTVVKKKGDGISPLREEAAGAEDEKVYTDRAKEKEPQKPNE
QRSKSLADIKESMENPQAKWLKSPTTPVDPEKQWNLASPSEETLNEGELLEYTKSIEKLN
SSLHFLQQEMQRLSLQQEMLMQMREQQSWVISPPQPSPQKQLRDFKPSRQTGLASTMAPF
SSDSPRPAHPSPQSSNRKSTSFSVKNQRTPRPNELKITPLNRTLTPPRSVDSLPRLRRFS
PSQVPIQTRSFVCFGDDGEPQLKESKPKEELKKEELECKGTSDHHEHNPEEKEIKPLEST
VSEVLSQPITETVCLTPNEDQLNQPIEPPPKPIFPPTAPKNVNLIEVSLSDLKPPEKADV
SVEKYDGESDKEQFDDDQKVCCGFFFKDDQKAENDMAMKRAALLEKRLRREKETQLRKQQ
LEAEMEHKKEETRRKTEEERQKKEDERARREFIRQEYMRRKQLKLMEDMDTVIKPRPQVT
KQKKQRPKSIHRDHIESPKTPVKGPPVSSLSLASLNTGDNESVHSGKRTPRSESVEGFLS
PSRCGSRNGEKDWENASTTSSVASGTEYTGPKLYKEPSAKSNKHIIQNALAHCCLAGKVN
EGQKKKILEEMEKSDANNFLILFRDSGCQFRSLYTYCPETEEINKLTGIGPKSITKKMIE
GLYKYNSDRKQFSHIPAKTLSASVDAITIHSHLWQTKRPVTPKKLLPTKA
Download sequence
Identical sequences G1STQ3
ENSOCUP00000006703 ENSOCUP00000024944 9986.ENSOCUP00000006703

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]