SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000006721 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000006721
Domain Number 1 Region: 237-355
Classification Level Classification E-value
Superfamily ApaG-like 1.44e-36
Family ApaG-like 0.00037
Further Details:      
 
Domain Number 2 Region: 76-143,170-200
Classification Level Classification E-value
Superfamily YccV-like 0.0000000000101
Family YccV-like 0.0073
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000006721   Gene: ENSOCUG00000007781   Transcript: ENSOCUT00000007780
Sequence length 368
Comment pep:known_by_projection chromosome:OryCun2.0:19:19756666:19768562:1 gene:ENSOCUG00000007781 transcript:ENSOCUT00000007780 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAGCAARRALAVGSRWWSRSLTGARGPRPLCAAWGAGAFLPAATTTTRRHLSSRNRAEGK
VLETVGVFEVPKQNGKYETGQLFLHSVFGYRGVVLFPWQARLYDRDVASAAPEKAENPAS
HGSKEVKGKTHTYYQVLIDARDCPHISQRSQTEAVTFLANHDDSRALYAIPGLDYVSHED
ILPYTSTDQVPIQHELFERFLLYDQTKAPPFVARETLRAWQEKNHPWLELSDVHRETTEN
IRVTVIPFYMGMREAQNSHVYWWRYCIRLENLDSDVVQLRERHWRIFSLSGTLETVRGRG
VVGREPVLSKEQPAFQYSSHVSLQASSGHMWGTFRFERPDGSHFDVRIPPFSLESNKDEK
TPPSGLHW
Download sequence
Identical sequences G1STS0
9986.ENSOCUP00000006721 ENSOCUP00000006721 ENSOCUP00000006721 XP_002718977.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]