SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000006991 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000006991
Domain Number 1 Region: 377-904
Classification Level Classification E-value
Superfamily Galactose mutarotase-like 1.73e-104
Family alpha-mannosidase, C-terminal domain 0.000000000156
Further Details:      
 
Domain Number 2 Region: 1-286
Classification Level Classification E-value
Superfamily Glycoside hydrolase/deacetylase 4.77e-93
Family alpha-mannosidase 0.000000000735
Further Details:      
 
Domain Number 3 Region: 287-391
Classification Level Classification E-value
Superfamily Families 57/38 glycoside transferase middle domain 1.44e-29
Family alpha-mannosidase, domain 2 0.0000077
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000006991   Gene: ENSOCUG00000008088   Transcript: ENSOCUT00000008088
Sequence length 913
Comment pep:novel scaffold:OryCun2.0:GL019378:30622:63078:-1 gene:ENSOCUG00000008088 transcript:ENSOCUT00000008088 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
ILDSVISALRAEPSRRFVYVEMAFFSRWWHQQTNATQQAVRELVRQGRLEFANGGWVMND
EAATHYGAIVDQMTLGLRFLQDTFGDDGRPRVAWHIDPFGHSREQASLFAQMGFDGIFLG
RVDYQDKEMRKKKREMEMVWRASTSLQPPTADLFTGVLPNVYHPPKDLCWDLLCHDNHVV
DDPADPGYNDKELAHYFLDVATYQRQSYRTNHTVMTMGDDFHYENANMWFSNLDKLIRLV
NAEQQANGSCVHVLYSTPACYLWELNKANLTWSLKEDDFFPYADGPHQFWTGYFSSRPAL
KRYERVSYNFLQVCKQLEALAGPAANVGPYGSGDSAPLEEAMAVLQHHDAITGTSRQLVA
DDFARRLAAGWGRCEVLLSNALARLSGSQEAFSICPELNISVCPLSQTSARFQVAIYNPL
ARKVDRMVRLPVSEGAFLVKDPSGHAVSSDVLLLPQPEGQKPSPELLFSASVPALGFSIY
SVARVSLQNPKAHSPKRIPQKSRTGVLVIQNEYIRATFSTKTGFLMQIEDMEQKLVLPVS
QSFFWYSAGTWDLKNIDVFGVSGAYIFRPSQPEPSPVSSWAKIHLLKTPLVQEVHQNFSA
WCAQVVRLYRGQRHLELEWTVGPIPLHDTWAVGESRVTLFEIFKTDYSFKREKNGNREIE
ISPPRVYVLTACLSLHEQGAGAHXPLQDRKKQLTVLTDRCQGGSSLQDGSLELMVHRRLL
LDDKQGLGEPLLEEGSGSWVRGRHLVLLDMVGKAAMGHRLLAQKEVLAPQVVLAPDTGTP
YHPGATQRTQFSGLRRELPPSVHLLTLARWGPETLLLRLEHQFASREDLGRNLSSPVTLN
LLDLFSTFTITRLQETTLAANQPRASASRLKWTPNSGPIRNLPVHRPDPAAITLQPMEIR
TFVAMVEWKSMPG
Download sequence
Identical sequences G1SUF9
9986.ENSOCUP00000006991 ENSOCUP00000006991 ENSOCUP00000006991

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]