SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000006993 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000006993
Domain Number 1 Region: 114-158
Classification Level Classification E-value
Superfamily LysM domain 0.0000000183
Family LysM domain 0.0043
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000006993   Gene: ENSOCUG00000008089   Transcript: ENSOCUT00000008090
Sequence length 943
Comment pep:known_by_projection chromosome:OryCun2.0:12:115274370:115402672:1 gene:ENSOCUG00000008089 transcript:ENSOCUT00000008090 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MDTKEEKKERKQSYFARLKKKKQAKQNAETASAIASRTHSGKEDATTVILDQDKCNIAVE
EEYIADEKKKRKSNQLKEIRRTELKRYYSIDDNQNKSHDKKEKKMVVQKPHGTIEYTAGS
QDTLNSIALKFNITPNKLVELNKLFTHTIVPGQVLFVPDANFPSSTLRLSSSSPGATVSP
SSSDAEYDKLPDADLARKALKPIERVLSSTSEEDEPGVVKFLKMNCRYFTDGKGVVGGVM
IVTPNNIMFDPHKSDPLVIENGCEEYGLICPMEEVVSIALYNDISHMKIKDALPSDLPQD
LCPLYRPGEWEDLASEKDINPFSKFKSISKEKRQQNGERTISSDPKSTGPLEKSREHTPT
KPSDGYMSGKFKKLESSRETTTGSPTVTKLPKKPSDANTAFESVTKENSLLGEHDDFVDL
EELSSQTESGMDKRDPSKECLSLDPEERKKAESPLISSAVEMQVRSALNFSGTESDAELK
GALDLETCEKQDIMPEVDKQSGSPENQVENTLNIHEDLDKVKLIEYYLNKNKEGSQLSEH
LQKAELSDGRSIEPVGIDITLSSSLPQADDLLTEGNKKTDKTWVKERGPLPLKLDPSTGE
NVDKESLDSSLDSALDNSCQGAQTDNKSEIQLWLLKRIQVPIEDILPSKEEKSKTPPMFL
CIKVGKPMRKSFATHTAAMVQQYGKRRKQPEYWFAVPRERVDHLYTFFVQWSPDVYGKDA
KEQGFVVVEKEELNMIDNFFSEPTTKSWEIITVEEAKRRKSTCSYYEDADEEVLPVLQPH
SALLENMHIEQLARRLPARVQGYPWRLAYSTLEHGTSLKTLYRKSASLDSPVLLVIKDMD
NQIFGAYATHPFKFSDHYYGTGETFLYTFSPNFKVFKWSGENSYFINGDISSLELGGGGG
RFGLWLDADLYHGRSNSCSTFNNDILSKKEDFIVQDLEVWTFE
Download sequence
Identical sequences G1SUG1
9986.ENSOCUP00000006993 ENSOCUP00000006993 ENSOCUP00000017022 XP_008261691.1.1745 XP_008261693.1.1745 XP_008261694.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]