SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000007173 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000007173
Domain Number 1 Region: 109-221
Classification Level Classification E-value
Superfamily C-type lectin-like 1.49e-25
Family C-type lectin domain 0.0000134
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000007173   Gene: ENSOCUG00000008297   Transcript: ENSOCUT00000008297
Sequence length 222
Comment pep:known_by_projection chromosome:OryCun2.0:1:190475239:190477441:-1 gene:ENSOCUG00000008297 transcript:ENSOCUT00000008297 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
LALLFGAVSALHLRTKTSNFESPLGDETLPQDRKVAGRGAEETPPGALTQLQEEVQEEGC
FRCEGALDEEGAAESGSDLDVVDTALQCPKEDDTVKLAISPGCKTCKRYILVRHAQTFNA
AEAVCQKCYRGNLVSIHSFNFNYLIRSAVHILSNIQVWIGATVTGPSNCQHFHWIDGSSW
NFAYWGHREPWGCSGTCISLGTRGGHWHRSHCATRLPFVCSY
Download sequence
Identical sequences G1SUW3
ENSOCUP00000007173

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]