SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000007195 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000007195
Domain Number 1 Region: 34-493
Classification Level Classification E-value
Superfamily ALDH-like 8.9e-172
Family ALDH-like 0.0000000000000644
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000007195   Gene: ENSOCUG00000008325   Transcript: ENSOCUT00000008326
Sequence length 498
Comment pep:novel chromosome:OryCun2.0:21:7745957:7774430:1 gene:ENSOCUG00000008325 transcript:ENSOCUT00000008326 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLRAAALAATGLRPFVGRRLLSAAATQAVPAPNQQPEVFYNQIFINNEWHDAASRKTFPT
VNPSTGEVICQVAEGDKEDVDRAVKAARAAFQLGSPWRRMDASERGRLLYRLADLIERDR
TYLAALETLDNGKPYVISYLVDLDMVLKCLRYYAGWADKYHGKTIPIDGDFFSFTRHEPV
GVCGQIIPWNFPLLMQAWKLGPALATGNVVVMKVAEQTPLTALYVANLIKEAGFPPGVVN
IVPGFGPTAGAAIASHHDVDKVAFTGSTEVGHLIQVAAGSSNLKRVTLELGGKSPNIIMS
DTDMDWAVEQAHFALFFNQGQCCCAGSRTFVQEDVYAEFVERSVARAKARVVGNPFDSQT
EQGPQVDETQFKKILGYFIQPTVFGDVQDGMTIAKEEIFGPVMQILKFKTIEEVVGRANN
SKYGLAAAVFTKDLDKANYLSQALQAGTVWVNCYDVFGAQSPFGGYKMSGSGRELGEYGL
QAYTEVKTVTVKVPQKNS
Download sequence
Identical sequences G1SUY2
ENSOCUP00000007195

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]