SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000007205 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000007205
Domain Number 1 Region: 51-334
Classification Level Classification E-value
Superfamily Dehydroquinate synthase-like 1.57e-77
Family Iron-containing alcohol dehydrogenase 0.0001
Further Details:      
 
Domain Number 2 Region: 383-457
Classification Level Classification E-value
Superfamily Dehydroquinate synthase-like 0.000000767
Family Iron-containing alcohol dehydrogenase 0.0094
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000007205   Gene: ENSOCUG00000008341   Transcript: ENSOCUT00000008339
Sequence length 461
Comment pep:known_by_projection chromosome:OryCun2.0:3:82299936:82336425:1 gene:ENSOCUG00000008341 transcript:ENSOCUT00000008339 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AMAAARARVAHLLRQLQRAACQCPTHSHTYSQVLAPGLSPSGRTTDYAFEMAVSNIRYGA
GVTKEVGMDLQNMGAKNVCLMTDKNLSRLPPVQVAMDSLVKNGIHFQVYDNVRVEPTDAS
FMDAIEFAKKGAFDAYVAVGGGSTMDTCKAANLYASSPNSDFLDYVNAPIGKGKPVCVPL
KPLIAVPTTSGTGSETTGVAIFDYEHLKVKTGIASRAIKPTLGLVDPLHTLHMPGQVVAN
SGFDVLCHALESYTAIPYHMRSPCPSNPITRPAYQGSNPISDLWAVHALRIVAKYLKRAV
RNPDDIEARSNMHLASTFAGIGFGNAGVHLWHNFKCFPICSLRIQEKKKKEFSPPPPRPI
HCLSINPASSAVSTVSALCLPGADIRSARTQDAGPMLADRLRKFLFELDVDDGLAAIGYS
KADIPALVKGTLPQERVTKLAPRPQSEEDLSALFEAAMKLY
Download sequence
Identical sequences G1SUY8
ENSOCUP00000007205 9986.ENSOCUP00000007205 ENSOCUP00000007205

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]