SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000007224 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000007224
Domain Number 1 Region: 325-381
Classification Level Classification E-value
Superfamily Endosomal sorting complex assembly domain 0.0000000000196
Family VPS37 C-terminal domain-like 0.01
Further Details:      
 
Domain Number 2 Region: 62-130
Classification Level Classification E-value
Superfamily UBC-like 0.00000000215
Family UBC-related 0.028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000007224   Gene: ENSOCUG00000008363   Transcript: ENSOCUT00000008362
Sequence length 397
Comment pep:known_by_projection chromosome:OryCun2.0:2:68579826:68628913:-1 gene:ENSOCUG00000008363 transcript:ENSOCUT00000008362 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSWLFPLSKSASSSVAGSPSGLTSLQQQKQRLIESLRNSHSSIAEIQKDVEYRLPFTVNN
LTININILLPPQFPQEKPVISVYPPIRHHLMDKQGIYVTSPLVNNFTMHSDLGKIIQSLL
DEFWKNPPVLAPTSTAFPYLYSNPSGMPPYSSQGFPFLPSYPPQEANRNISSLSVADTVS
SSTTSYTTAKPAAPSFGILSNLPLPVPTADTSTPISQNGFGYKMPEVPEAFPELSELSVS
QLTDMNEQEEILLEQFLTLPQLKQIINDKDDLVKSIEELARKNLLLEPSLEAKRQTVLEK
YELLTQMKSTFEKKMQRQHELSESCSASALQARLKVAAHEAEEESDNIAEDFLEGKTEID
DFLSSFMEKRTICHCRRAKEEKLQQVIAMHSQFHAPL
Download sequence
Identical sequences G1SV02
9986.ENSOCUP00000007224 ENSOCUP00000007224 ENSOCUP00000007224 XP_002709556.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]