SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000007524 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000007524
Domain Number 1 Region: 44-137
Classification Level Classification E-value
Superfamily FKBP-like 3.73e-29
Family FKBP immunophilin/proline isomerase 0.00000191
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000007524   Gene: ENSOCUG00000008715   Transcript: ENSOCUT00000008713
Sequence length 138
Comment pep:novel chromosome:OryCun2.0:X:50888725:50899604:1 gene:ENSOCUG00000008715 transcript:ENSOCUT00000008713 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AYDQVSKMPPKGKSGSGKGGKGGAASGSDNADKKAQGPKGGGNAVKVRHILCEKHGKIME
AMEKLKSGMKFSEVAAQYSEDKARQGGDLGWMTRGSMVGPFQEAAFALPVSGMDKPVFTD
PPVKTKFGYHIIMVEGRK
Download sequence
Identical sequences G1SVQ4
ENSOCUP00000007524 ENSOCUP00000007524 9986.ENSOCUP00000007524

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]