SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000007630 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000007630
Domain Number 1 Region: 111-322
Classification Level Classification E-value
Superfamily Glutamine synthetase/guanido kinase 1.18e-53
Family Glutamine synthetase catalytic domain 0.011
Further Details:      
 
Domain Number 2 Region: 22-109
Classification Level Classification E-value
Superfamily Glutamine synthetase, N-terminal domain 2.22e-20
Family Glutamine synthetase, N-terminal domain 0.0052
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000007630   Gene: ENSOCUG00000008841   Transcript: ENSOCUT00000008837
Sequence length 333
Comment pep:known_by_projection scaffold:OryCun2.0:GL019499:22412:25783:-1 gene:ENSOCUG00000008841 transcript:ENSOCUT00000008837 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MATSASSHLNKGIKQVYMGLPQGEKVQAMYIWIDGTGEGLRCKTRTLDCEPKCVEELPEW
NFDGSSTFQSEGSNSDMYLVPAAMFRDPFRKDPNKLVFCEVFKYNRKPAESNLRHSCKRI
MDMVSSQRPWFGMEQEYTLMGTDGHPFGWPSNGFPGPQGPYYCGVGADRAYGRDIVEAHY
RACLYAGIKIAGTNAEVMPAQPIPGNWNGAGCHTNFSTKAMREEDGLKHIEEAIEKLSRR
HQYHIRAYDPKGGLDNARRLTGFHETSNINDFSAGVANRSASIRIPRTVGQERRGYFEDR
RPSANCDPFAVTEALIRTCLLNETGDEPFQYKN
Download sequence
Identical sequences G1SW00
ENSOCUP00000007630

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]