SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000007804 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOCUP00000007804
Domain Number - Region: 123-173
Classification Level Classification E-value
Superfamily Cgl1923-like 0.00706
Family Cgl1923-like 0.021
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000007804   Gene: ENSOCUG00000009037   Transcript: ENSOCUT00000009036
Sequence length 247
Comment pep:known_by_projection chromosome:OryCun2.0:13:41777071:41779459:1 gene:ENSOCUG00000009037 transcript:ENSOCUT00000009036 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGAAVFFGCTFVAFGPAFALFLITVAGDPLRVIILVAGAFFWLVSLLLASVVWFILVHVT
DRSDARLQYGLLIFGAAVSVLLQEVFRFAYYKLLKKADEGLASLSEDGRSPISIRQMAYV
SGLSFGIISGVFSVINILADALGPGVVGIHGDSPYYFLTSAFLTAAIILLHTFWGVVFFD
ACERRRYWALGLVVGSHLLTSGLTFLNPWYEASLLPIYAVTVSMGLWAFITAGGSLRSIQ
RSLSCKD
Download sequence
Identical sequences A0A1A6HMI3 G1SWE2
ENSOCUP00000007804 ENSFCAP00000025658 9986.ENSOCUP00000007804 ENSOCUP00000007804

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]