SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000008262 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000008262
Domain Number 1 Region: 375-489,608-748
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 8.36e-67
Family Phosphate binding protein-like 0.00000000111
Further Details:      
 
Domain Number 2 Region: 2-355
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 5.05e-62
Family L-arabinose binding protein-like 0.0011
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000008262
Domain Number - Region: 499-603
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.000746
Family Voltage-gated potassium channels 0.016
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000008262   Gene: ENSOCUG00000009583   Transcript: ENSOCUT00000009585
Sequence length 849
Comment pep:known_by_projection chromosome:OryCun2.0:14:159012362:159177522:-1 gene:ENSOCUG00000009583 transcript:ENSOCUT00000009585 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPNTTLTYDIQRINLFDSFEASRRACDQLALGVAALFGPSHSSSVSAVQSICNALEVPHI
QTRWKHPSVDNKDLFYINLYPDYAAISRAVLDLVLYYNWKTVTVVYEDSTGLIRLQELIK
APSRYNIKIKIRQLPSGNKDAKPLLKEMKKGKEFYVIFDCSHETAAEILKQILFMGMMTE
YYHYFFTTLDLFALDLELYRYSGVNMTGFRLLNIDNPHVSSIIEKWSMERLQAPPRPETG
LLDGMMTTEAALMYDAVYMVAIASHRASQLTVSSLQCHRHKPWRLGPRFMNLIKEAQWDG
LTGRITFNKTDGLRKNFDLDIISLKEEGTEKAAGEVSKHLYKVWKKIGIWNSNSGLNMTE
GNKDRSNNITDSLANRTLIVTTILEEPYVMYKKSDKPLYGNDRFEGYCLDLLKELSNILG
FIYDVKLVPDGKYGAQNDKGEWNGMVKELIDHKADLAVAPLTITYVREKVIDFSKPFMTL
GISILYRKPNGTNPGVFSFLNPLSPDIWMYVLLACLGVSCVLFVIARFTPYEWYNPHPCN
PDSDVVENNFTLLNSFWFGVGALMQQGSELMPKALSTRIVGGIWWFFTLIIISSYTANLA
AFLTVERMESPIDSADDLAKQTKIEYGAVRDGSTMTFFKKSKISTYEKMWAFMSSRQQTA
LVKNNDEGIQRVLTTDYALLMESTSIEYVTQRNCNLTQIGGLIDSKGYGVGTPIGSPYRD
KITIAILQLQEEGKLHMMKEKWWRGNGCPEEDNKEASALGVENIGGIFIVLAAGLVLSVF
VAIGEFIYKSRKNNDVEQCLSFNAIMEELGISLKNQKKLKKKSRTKGKSSFTSILTCHQR
RTQRKETVA
Download sequence
Identical sequences G1SXH9
ENSOCUP00000008262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]