SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000008329 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)

No Significant Hits.

Weak hits

Sequence:  ENSOCUP00000008329
Domain Number - Region: 174-242,328-359,422-564
Classification Level Classification E-value
Superfamily Quinoprotein alcohol dehydrogenase-like 0.000667
Family Quinoprotein alcohol dehydrogenase-like 0.035
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000008329   Gene: ENSOCUG00000009662   Transcript: ENSOCUT00000009664
Sequence length 577
Comment pep:known_by_projection chromosome:OryCun2.0:1:104154374:104190295:-1 gene:ENSOCUG00000009662 transcript:ENSOCUT00000009664 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MFFQIFLGFVSNLSTIAVGFLSVIMHRLSVLKKSMGTVSPHQKEAIVGQRQNLPCIEPLV
STVEETPGMVSARVRGHLPEWLNGYLLRIGPGKFEFGKDKYNHWFDGMALLHQFRMEKGT
VTYRSKFLQSDTYKANSVHNRIMISEFGTLALPDPCKNVFERFMSKFEPTATTDNTNVNY
VQYKGDYYVSTETNFMNKVDIETLEKTEKVDWSKFIAVNGATAHPHYDSDGTAYNMGNSY
GPRGSCYNVIRVPPEKADVGETIHGAEVICSIAPAESTKPSYYHSFGMTRNYIIFIEQPL
KMNLWKIVTSKIRGKAISDGISWEPQYNTRFHVVDKHTGQLLPEMYYSEPFVTFHQINAF
EDQGCIVIDMCCQDNGKSLDVYQLQNLRRAGKGLDQVYNSVARSFPRRFVLPLNVSINAP
EGKNLSPLTYSSASAVKQADGKIWCSHESLHHKDLMEEGGIEFPQINYGKFSGKKYRFFY
GCGFRHLVGDSLIKVDVVNKTLKVWRKDGFYPSEPIFVPVPGASEEDGGVVLSVVITPNQ
NESNFLLVLDAKNFEELGRAEVPVQIPYGFHGTFIPI
Download sequence
Identical sequences G1SXN4
ENSOCUP00000008329 XP_008259623.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]