SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000008360 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000008360
Domain Number 1 Region: 32-128
Classification Level Classification E-value
Superfamily Kringle-like 5.56e-28
Family Kringle modules 0.00084
Further Details:      
 
Domain Number 2 Region: 216-323
Classification Level Classification E-value
Superfamily Spermadhesin, CUB domain 3.27e-25
Family Spermadhesin, CUB domain 0.0017
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000008360
Domain Number - Region: 148-247
Classification Level Classification E-value
Superfamily WD40 repeat-like 0.0659
Family WD40-repeat 0.015
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000008360   Gene: ENSOCUG00000009703   Transcript: ENSOCUT00000009704
Sequence length 499
Comment pep:known_by_projection scaffold:OryCun2.0:GL018723:2359252:2432009:1 gene:ENSOCUG00000009703 transcript:ENSOCUT00000009704 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAPPAARLALLSAAALTLAARPAPSPGLGPGPECFTANGADYRGTQNWTALQGGKPCLFW
NETFQHPYNTLKYPNGEGGLGEHNYCRNPDGDVSPWCYVAEHEDGVYWKYCEIPACQMPG
NLGCYKDHGNPPPLTGTSKTSNKLTIQTCISFCRSQRFKFAGMESGYACFCGNNPDYWKY
GEAASTECNSVCFGDHTQPCGGDGRIILFDTRVGACGGNYSAMTSVIYSPDFPDNYATGR
VCYWTIRVPGASHMHFNFTLFDIRDSADMVELLDGYTHRVLVRFSGRHRPPSSFNVSLDF
IILYFFSDRINQAQGFAVLYQAVKEEPPQERPTVNQTVAEVITEQANLSVSAARSSKVLY
VITTSPSHPPQTVPGSNSWASSVGVGSHRVEGWTVYGLATLLILTVTAIVAKILLHVTFK
SHRVPASGDLRDCRQPGTSGEIWSIFYKPSTSISIFKKKLKGQSQQDDRNPLYFRASSSL
VAALTCSCSSAEWERARRR
Download sequence
Identical sequences G1SXR3
ENSOCUP00000008360

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]