SUPERFAMILY 1.75 HMM library and genome assignments server

SUPERFAMILY 2 can be accessed from supfam.org. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000008507 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000008507
Domain Number 1 Region: 13-170
Classification Level Classification E-value
Superfamily (Phosphotyrosine protein) phosphatases II 3.94e-44
Family Dual specificity phosphatase-like 0.00045
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000008507   Gene: ENSOCUG00000009880   Transcript: ENSOCUT00000009877
Sequence length 198
Comment pep:known_by_projection chromosome:OryCun2.0:19:25440410:25441006:-1 gene:ENSOCUG00000009880 transcript:ENSOCUT00000009877 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSRGHSTLPRTLMAPRMISEGDTGGIAQITSSLFLGRGSVASNRHFLQARGITCIVNAT
IEIPNFNWPQFEYVKVPLADMPHAPIGLYFDSVADKIHSVSRKHGATLVHCAAGVSRSAT
LCIAYLMKFHNVCLLEAYNWVKARRPVIRPNVGFWRQLIDYERQLFGKSTVKMVQTPYGI
VPDVYEKESRHLMPYWGI
Download sequence
Identical sequences G1SY34
ENSOCUP00000008507 9986.ENSOCUP00000008507 ENSOCUP00000008507 XP_008269377.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]