SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000008780 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000008780
Domain Number 1 Region: 171-646
Classification Level Classification E-value
Superfamily ALDH-like 6.41e-135
Family ALDH-like 0.00000102
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000008780   Gene: ENSOCUG00000010185   Transcript: ENSOCUT00000010187
Sequence length 658
Comment pep:known_by_projection chromosome:OryCun2.0:3:10371219:10412184:-1 gene:ENSOCUG00000010185 transcript:ENSOCUT00000010187 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRIFYAQAHPSARSGFPHAGPPYQSGPRPHRPGSHAGAHPLLASLPRARHSPRFPPARRA
AIVPGRNPAPNSARRPGRVGGAPAGGVAGPVQSALPAGGRVPTSAAPRGAGAAAPRALSM
WRLSRALCVRAAKTGQLPGPCKRPAAFMSTLLIQQPQYAWLKELGLREDNEGVYNGSWGG
RGEVITTYCPANNEPIARVRQASVADYEETVKKAREAWRVWADIPAPKRGEIVRQIGDAL
REKIQVLGSLVSLEMGKILVEGVGEVQEYVDICDYAVGLSRMIGGPVLPSERPGHALIEQ
WNPVGLVGIITAFNFPVAVYGWNNAIAMICGNVCLWKGAPTTSLISVAVTKIIAKVLEDN
RLPGAICSLTCGGADIGTAMAKDERVNLLSFTGSTQVGKQVALMVQERFGRSLLELGGNN
AIIAFEDADLSLVVPSALFAAVGTAGQRCTTARRLFLHESIHDEVVNRLTKAYAQIRVGN
PWDSNVLYGPLHTKQAVSMFLGAVEEAKKEGGTVVYGGKVMDRPGNYVEPTIVTGLAHDA
AIAHTETFAPILYVFKFKDEDEVFAWNNEVKQGLSSSIFTKDLGRIFRWLGPRGSDCGIV
NVNIPTSGAEIGGAFGGEKHTGGGRESGSDAWKQYMRRSTCTINYSKDLPLAQGIKFQ
Download sequence
Identical sequences G1SYS5
ENSOCUP00000008780

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]