SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000008944 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000008944
Domain Number 1 Region: 2-420
Classification Level Classification E-value
Superfamily ALDH-like 2.09e-153
Family ALDH-like 0.00000000000979
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000008944   Gene: ENSOCUG00000010380   Transcript: ENSOCUT00000010380
Sequence length 424
Comment pep:known_by_projection chromosome:OryCun2.0:13:27205966:27237449:1 gene:ENSOCUG00000010380 transcript:ENSOCUT00000010380 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERCRILLEAARIMRERKDEIATVETINNGKSIFEARWDIDTSWQCLEYYAGLAASMAGE
HIQLPGGSFGYTRREPLGVCVGIGAWNYPFQIACWKSAPALACGNAMIFKPSPFTPVSAL
LLAEIYTAAGVPPGLFNVVQGGAATGQLLCQHQDVAKVSFTGSVPTGSKIMEMSAKGIKP
VTLELGGKSPLIIFSDCDMKNAVNGALMANFLTQGEVCCNGTRVFVQKEILDKFTEEVVK
KTQKIKIGDPLLEDTRMGPLINRPHLERVLGFIKVAKEQGAKVLCGGDLYVPEDPKLKDG
YYMRPCVLTNCRDDMTCVKEEIFGPVMSILSFDTEAEVVERANNTTFGLAAGVFTRDIQR
AHRVVAELQAGMCFINNYNVSPVELPFGGYKKSGFGRENGRVTIEYYSQLKTVCVEMGDV
ESTF
Download sequence
Identical sequences G1SZ63
ENSOCUP00000008944

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]