SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000009161 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000009161
Domain Number 1 Region: 12-222
Classification Level Classification E-value
Superfamily Heme oxygenase-like 1.02e-71
Family Eukaryotic type heme oxygenase 0.0000000105
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000009161   Gene: ENSOCUG00000010633   Transcript: ENSOCUT00000010632
Sequence length 288
Comment pep:known chromosome:OryCun2.0:4:86060985:86066691:-1 gene:ENSOCUG00000010633 transcript:ENSOCUT00000010632 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MERTHPDSLPQDLSEALKEATKEVHTQAENAEFMKNFQKGQVTAEGFKLVMASLYHIYVA
LEEEIEHNKENPVYAPLYFPEELHRKPALELDMAFWYGPRWQETIPYTPATRRYVQRLQQ
VGRAEPELLVAHAYTRYLGDLSGGQVLKKIAQKALDLPSSGEGVAFFTFPHIASATKFKQ
LYRSRMNSLEMTPSVRQRVVEEAKAAFLLNIQLFEELQELLVQDAQGQSPSQAPGLRQRT
GSRTQDSTPVEPPRGKSQLSSLSQPPLLRWVLTLSFLVATVAMGLYAM
Download sequence
Identical sequences G1SZP6
9986.ENSOCUP00000009161 XP_002711461.1.1745 ENSOCUP00000009161 ENSOCUP00000009161

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]