SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000009474 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000009474
Domain Number 1 Region: 296-554
Classification Level Classification E-value
Superfamily Trypsin-like serine proteases 4.18e-76
Family Eukaryotic proteases 0.0000984
Further Details:      
 
Domain Number 2 Region: 172-278
Classification Level Classification E-value
Superfamily Kringle-like 1.23e-31
Family Kringle modules 0.00033
Further Details:      
 
Domain Number 3 Region: 73-118
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00000000585
Family EGF-type module 0.013
Further Details:      
 
Domain Number 4 Region: 111-148
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000393
Family EGF-type module 0.022
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000009474   Gene: ENSOCUG00000011012   Transcript: ENSOCUT00000011014
Sequence length 558
Comment pep:known_by_projection chromosome:OryCun2.0:18:61158734:61189691:1 gene:ENSOCUG00000011012 transcript:ENSOCUT00000011014 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MCAKMFPLHLLLLMVLVGKTSIGFSLTSLLEDLDPDWTPDNYDYSYEHYNQGENTGATPA
YPENPDWYYAEDDPCQSNPCDHGGTCVVSQDTFKCKCPAPFSGNRCQKVQNKCVNNPCGR
GECLITQSPPYFRCTCKYPHTGPDCSRVVPACRPNPCQNGGTCFRHKRRSRFRCACADQY
RGRFCEIGPDDCYTGDGYSYRGQVSRTVNQHPCLYWNSHLLLQENYNMFMEDAEAHGIGE
HNFCRNPDGDKKPWCFVKVNSEKVKWEYCAVSACSTPDTDNLEGSPAEPLVKIPGFDTCG
KTEVAERKLKRIYGGFKSTAGKHPWQASLQTSMPLTVSMPQGHFCGGTLIHPCWVLTAAH
CTDIKIKHLKVVLGDQDLKKTEFHEQTFGVEKIVKYSHYNERDEIPHNDIALLKLKPVDG
HCALESKYVKTVCLPDGPFPSGTECHISGWGVTETGEGSRQLLDAKVKLIANTLCNSRRL
YDHMIDDSMICAGNLQKPGQDTCQGDSGGPLTCEKNGTYYISGIVSWGLECGKKPGVYTQ
VTRFLSWIKATIQREAAV
Download sequence
Identical sequences G1T0F8
XP_008268749.1.1745 ENSOCUP00000009474

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]