SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000009491 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000009491
Domain Number 1 Region: 26-366
Classification Level Classification E-value
Superfamily ADP-ribosylglycohydrolase 1.7e-68
Family ADP-ribosylglycohydrolase 0.00029
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000009491   Gene: ENSOCUG00000011038   Transcript: ENSOCUT00000011033
Sequence length 369
Comment pep:known_by_projection scaffold:OryCun2.0:GL018704:2240765:2246710:-1 gene:ENSOCUG00000011038 transcript:ENSOCUT00000011033 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
VARARMAAAAAVMAAGCGGAGPARSLSRFRGCLAGALLGDCVGAVYEAHDTVNLTSVLRH
VQSLEPDPGTPGSARTEALYYTDDTAMARALVQSLLAKEAFDEVDMAHRFAQEYKKDPDR
GYGAGVITVFKKLLSPKCRDVYEPARAQFNGKGSYGNGGAMRVAGIPLAYSSIQDVQKFA
RLSAQLTHASSLGYNGAILQALAVHLALQGESSREHFLEQLLGHMEGLEGDAQSVLDARE
LGMEERPFSSRLKKIGELLGQDSVTREEVVSELGNGIAAFESVPTAIYCFLRCMEPDPEI
PPAFNSLQRTLIYSISLGGDTDTIATMAGAIAGAYYGMDQVPESWQQSCEGYQETDILAQ
SLHRIFQKS
Download sequence
Identical sequences G1T0H0
ENSOCUP00000009491 9986.ENSOCUP00000009491 ENSOCUP00000009491

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]