SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000009643 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000009643
Domain Number 1 Region: 3-101
Classification Level Classification E-value
Superfamily FKBP-like 1.41e-37
Family FKBP immunophilin/proline isomerase 0.00000129
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000009643   Gene: ENSOCUG00000008793   Transcript: ENSOCUT00000011207
Sequence length 102
Comment pep:known chromosome:OryCun2.0:2:173173000:173216362:1 gene:ENSOCUG00000008793 transcript:ENSOCUT00000011207 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
AVSPGDGRTFPKKGQTCVVHYTGMLQNGKKFDSSRDRNKPFKFRIGKQEVIKGFEEGAAQ
MSLGQRAKLTCTPDVAYGATGHPGVIPPNATLIFDVELLNLE
Download sequence
Identical sequences G1T0U7
ENSOCUP00000009643

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]