SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000009761 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000009761
Domain Number 1 Region: 52-101
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), beta-barrel domain 4.97e-19
Family Transcription factor IIA (TFIIA), beta-barrel domain 0.0000808
Further Details:      
 
Domain Number 2 Region: 3-53
Classification Level Classification E-value
Superfamily Transcription factor IIA (TFIIA), alpha-helical domain 1.28e-17
Family Transcription factor IIA (TFIIA), alpha-helical domain 0.0000867
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000009761   Gene: ENSOCUG00000011347   Transcript: ENSOCUT00000011342
Sequence length 134
Comment pep:known_by_projection chromosome:OryCun2.0:17:12749222:12756102:1 gene:ENSOCUG00000011347 transcript:ENSOCUT00000011342 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAYQLYRNTTLGNSLQESLDELIQSQQITPQLALQVLLQFDKAINSALAQRVRNRVNFRG
SLNTYRFCDNVWTFVLNDVEFREVTELIKVDKVKIVACDGKSKCSLKNNEWKNGSFLCHL
LLYSLLFEKKHRRD
Download sequence
Identical sequences G1T148
ENSOCUP00000009761 9986.ENSOCUP00000009761 ENSOCUP00000009761

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]