SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000009838 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000009838
Domain Number 1 Region: 357-467,578-726
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 8.39e-52
Family Phosphate binding protein-like 0.0000142
Further Details:      
 
Domain Number 2 Region: 2-341
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 1.37e-23
Family L-arabinose binding protein-like 0.007
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000009838
Domain Number - Region: 485-571
Classification Level Classification E-value
Superfamily Voltage-gated potassium channels 0.0157
Family Voltage-gated potassium channels 0.013
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000009838   Gene: ENSOCUG00000011440   Transcript: ENSOCUT00000011438
Sequence length 922
Comment pep:known_by_projection chromosome:OryCun2.0:15:56122277:56895568:-1 gene:ENSOCUG00000011440 transcript:ENSOCUT00000011438 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MNQGILALVSSIGCTSAGSLQSLADAMHIPHLFIQRSTAGTPRSGCGLTRSSRNDDYTLS
VRPPVYLNDVILRVVTEYAWQKFIIFYDSEYDIRGIQEFLDKVSQQGMDVALQKVENNIN
KMITTLFDTMRIEELNRYRDTLRRAILVMNPATAKSFITEVVETNLVAFDCHWIIINEEI
NDMDVQELVRRSIGRLTIIRQTFPVPQNISQRCFRGNHRISSTLCDPKDPFAQNMEISNL
YIYDTVLLLANAFHKKLEDRKWHSMASLSCIRKNSKPWQGGRSMLETIKKGGVNGLTGEL
EFGENGGNPNVHFEILGTNYGEELGRGVRKLGCWNPVTGLNGSLTDKKLENNMRGVVLRV
VTVLEEPFVMVSENVLGKPKKYQGFSIDVLDALSNYLGFNYEIYVAPDHKYGSPQEDGTW
NGLVGELVFKRADIGISALTITPDRENVVDFTTRYMDYSVGVLLRRAEKTVDMFACLAPF
DLSLWACIAGTVLLVGLLVYLLNWLNPPRLQMGSMTSTTLYNSMWFVYGSFVQQGGEVPY
TTLATRMMMGAWWLFALIVISSYTANLAAFLTITRIESSIQSLQDLSKQTDIPYGTVLDS
AVYEQVRMKGLNPFERDNMYSQMWRMINRSNGTENNVLESPAGIQKVKHGNYAFVWDAAV
LEYVAINDPECSFYTVGNTVADRGYGIALQHGSPYRDVFSQRILELQQNGDMDILKHKWW
PKNGQCDLYSSVDTKQKGGALDIRSFAGVFCILAAGIVLSCLIAMLETWWNKRKGSRVPS
KEDDKEIDLEHLHRRVNSLCTDDDSPHKQFSTSSIDLTPLDIDTLPTRQALEQISDFRNT
HITTTTFIPEQIQTLSRTLSAKAASGFAFGNVPEHRTGPFRHRAPNGGFFRSPIKTMSSI
PYQPTPTLGLNLGNDPDRGTSI
Download sequence
Identical sequences G1T1A9
ENSOCUP00000009838

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]