SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000009929 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000009929
Domain Number 1 Region: 122-365
Classification Level Classification E-value
Superfamily vWA-like 2.22e-83
Family Integrin A (or I) domain 0.000000366
Further Details:      
 
Domain Number 2 Region: 342-451
Classification Level Classification E-value
Superfamily Integrin domains 2.04e-18
Family Integrin domains 0.0018
Further Details:      
 
Domain Number 3 Region: 620-700
Classification Level Classification E-value
Superfamily Integrin beta tail domain 0.0000000000000051
Family Integrin beta tail domain 0.0036
Further Details:      
 
Domain Number 4 Region: 22-81
Classification Level Classification E-value
Superfamily Plexin repeat 0.000000000000282
Family Plexin repeat 0.0022
Further Details:      
 
Domain Number 5 Region: 534-574
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000000149
Family Integrin beta EGF-like domains 0.0015
Further Details:      
 
Domain Number 6 Region: 578-617
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0000335
Family Integrin beta EGF-like domains 0.0083
Further Details:      
 
Weak hits

Sequence:  ENSOCUP00000009929
Domain Number - Region: 456-483
Classification Level Classification E-value
Superfamily EGF/Laminin 0.00586
Family Integrin beta EGF-like domains 0.029
Further Details:      
 
Domain Number - Region: 499-534
Classification Level Classification E-value
Superfamily EGF/Laminin 0.0363
Family Integrin beta EGF-like domains 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000009929   Gene: ENSOCUG00000011544   Transcript: ENSOCUT00000011545
Sequence length 771
Comment pep:known_by_projection scaffold:OryCun2.0:GL019419:5423:21550:1 gene:ENSOCUG00000011544 transcript:ENSOCUT00000011545 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLGWRPLLLALAGLLSLPSVLSQECTKYKVSNCRDCIQSGPGCAWCQKLNFTAPGEPDSI
RCDTRDQLRAKGCELDNIVDPRSLAEPQEELDGGRKQLSPQRVTLFLRPGQAAAFNVTFR
RAKGYPIDLYYLMDLSYSMLDDLINVKKLGGDLLRALNEITESGRVGFGSFVDKTVLPFV
NTHPEKLRNPCPNKEKECQAPFAFRHVLKLTSNSEQFRTEVGKQLISGNLDAPEGGLDAM
MQVAVCPEEIGWRNVTRLLVYATDDGFHFAGDGKLGAILTPNDGQCHLEGNMYRRSNEFD
YPSVGQLAHKLAENNIQPIFAVTKKMVKTYEKLTEIIPKSAVGELSEDSSNVVQLIKDAY
SKLSSRVFLEHSALPDSLRVTYDSFCSKGTLLGQRRGDCDDVQINVPVTFQVKVTASECI
QEKSFVIRALGFTDTVTVRVLPLCECRCRDQRQERGLCGGKGSMECGVCRCDAGYTGKNC
ECQTQGRSSQELEGSCRKDNSSIVCSGLGDCICGQCVCHTSDNPNKQIFGRYCECDNMNC
ERYDGQVCGGKKRGSCSCGQCHCNDGFEGSACQCKKSTDGCLDAQGVECSGRGQCRCNVC
VCKKGYQPPMCQECLGCTSPCGQYISCIECLKFDKGPFGKNCSTQCKNLQLVDVALRGKT
CKTCKEQDSEGCWMAFTLCQRQGMDNYDVHVEDSRECVQGPNIAAIVGGTVAGVVLIGVL
LLVIWKALTHLSDLREYRRFEKEKLKSQWNNDNPLFKSATTTVMNPKFTQS
Download sequence
Identical sequences G1T1H9
9986.ENSOCUP00000009929 ENSOCUP00000009929 ENSOCUP00000009929

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]