SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000009990 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000009990
Domain Number 1 Region: 7-486
Classification Level Classification E-value
Superfamily ALDH-like 3.8e-162
Family ALDH-like 0.0000000156
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000009990   Gene: ENSOCUG00000011613   Transcript: ENSOCUT00000011615
Sequence length 487
Comment pep:known_by_projection chromosome:OryCun2.0:12:125323943:125352999:-1 gene:ENSOCUG00000011613 transcript:ENSOCUT00000011615 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MAATEAPLVLENFIGGTFVPCKSYIDSYDPSTGEVYCKVPNSGKEEIEAAVEAARGAFPG
WSSRSPQERARVLNQVADLLEQSLEELARAESRDQGKTVTLARTMDIPRSVQNFRFFASS
SLHHTAECTHMDHVDCLHYTVRTPVGIAGLISPWNLPLYLLTWKIAPAIAAGNTVIAKPS
ELTSVTAWMLCRLLNKAGVPPGVVNIVFGTGPRVGEALVAHPEVPVISFTGSQPTAERIT
QLSAPHCKKLSLELGGKNPAVIFEDANLEECIPETVRSSFANQGEVCLCTSRIFVQKSIY
REFLKRFVEATRKWKVGIPSDPSASMGALISKAHLEKVRSYIEKARAEGAQILCGEGVDK
LNLPPRNQAGYFMLPTVITDIKDDSCCMKEEIFGPVTCVVPFDSEEEVIKRANNVKYGLA
ATVWSSNVGRIHRVAKKLQAGLVWTNCWLIRELNLPFGGMKSSGVGREGLKDSYDFFTEI
KTITVKH
Download sequence
Identical sequences G1T1M5
ENSOCUP00000009990 ENSOCUP00000009990 9986.ENSOCUP00000009990 XP_002714879.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]