SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000010076 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000010076
Domain Number 1 Region: 183-267
Classification Level Classification E-value
Superfamily Translation initiation factor IF3, C-terminal domain 3.14e-19
Family Translation initiation factor IF3, C-terminal domain 0.0033
Further Details:      
 
Domain Number 2 Region: 105-175
Classification Level Classification E-value
Superfamily Translation initiation factor IF3, N-terminal domain 0.000000000127
Family Translation initiation factor IF3, N-terminal domain 0.0032
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000010076   Gene: ENSOCUG00000011721   Transcript: ENSOCUT00000011720
Sequence length 305
Comment pep:known_by_projection scaffold:OryCun2.0:GL018735:491988:501761:-1 gene:ENSOCUG00000011721 transcript:ENSOCUT00000011720 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MQTRAVQHGFDWVRIIIKWISHQISALMAAVLKRLILQTVKSENNCIRRCFGEHLMQKTD
PAQLSLIASAPRPSYLPHAKAFSTAEDTQAERKKTKKNETSFSNVGRKIKERIIHVLDEK
GNDLGNMHRAEVIRLMDERDLRLVQRDAHAEPPEYQLMTGLQIHKERLRLREMEKAQPKA
GPILTKELTFSSNIGQHDLDTKNKQIQQWIEKKYQVQITIKKGKNADEPENKTEELFNQI
LQTMPGIATFKSKPQAVKGGKAVMCVLRHLSKKEENTYKESQGTQKRDTLHKESRSEKES
NDPHQ
Download sequence
Identical sequences G1T1U3
XP_017192991.1.1745 ENSOCUP00000010076

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]