SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000010091 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000010091
Domain Number 1 Region: 12-268
Classification Level Classification E-value
Superfamily Carbonic anhydrase 8.64e-97
Family Carbonic anhydrase 0.000000000143
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000010091   Gene: ENSOCUG00000011736   Transcript: ENSOCUT00000011737
Sequence length 269
Comment pep:known_by_projection chromosome:OryCun2.0:3:101076260:101086804:1 gene:ENSOCUG00000011736 transcript:ENSOCUT00000011737 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MSSPVTGKATSKEWGYADHNGPDHWHELFPNAKGDNQSPIELHTKDVRHDPSLLPWSASY
DPGSAKTILNNGKTCRVVFDDTYDRSMLRGGPLPGPYRLRQFHLHWGSSDDHGSEHIVDG
VKYAAELHLVHWNPKYNTYGEALKQPDGIAVVGVFLKIGREKGDFQIFLDALDKIKTKGK
EAPFSHFDPSCLFPACRDYWTYRGSFTTPPCEECIVWLLLKEPITVSSDQIAKLRSLFSS
AENEPPVPMVRNWRPPQPIKGRVVRASFK
Download sequence
Identical sequences G1T1V5
9986.ENSOCUP00000010091 ENSOCUP00000010091 ENSOCUP00000010091 XP_002710715.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]