SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000010159 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000010159
Domain Number 1 Region: 11-368
Classification Level Classification E-value
Superfamily Glyoxalase/Bleomycin resistance protein/Dihydroxybiphenyl dioxygenase 3.12e-90
Family Extradiol dioxygenases 0.0000000237
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000010159   Gene: ENSOCUG00000011816   Transcript: ENSOCUT00000011818
Sequence length 393
Comment pep:known_by_projection scaffold:OryCun2.0:GL018824:775514:782792:1 gene:ENSOCUG00000011816 transcript:ENSOCUT00000011818 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MTTYSDKGAKPERGRFLHFHSVTFWVGNAKQAASFYCTKMGFEPLAYRGLETGSRQVVSH
VIKQGQIVFVLSSALNPGNKEMGDHLVKHGDGVKDIAFEVEDCDYIVQKARERGAKILRE
PWVEQDKFGKVKFAVLQTYGDTTHTLVEKMNYTGRFLPGFEAPMSKDPLLSKLPSCSLEI
IDHIVGNQPEQEMVSASEWYLRNLQFHRFWSVDDTQVHTEYSSLRSIVVANYEESIKMPI
NEPAPGRKKSQIQEYVDYNGGAGVQHIALKTHDIISAIRHLRERGMEFLAVPATYYKQLR
EKLRSAKIRVTESIDVLEELKILVDYDEKGYLLQIFTKPMQDRPTLFLEVIQRHNHQGFG
AGNFNSLFKAFEEEQNLRGNLTDMETNGVVPGM
Download sequence
Identical sequences G1T218
ENSOCUP00000010159 XP_008248783.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]