SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000010232 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000010232
Domain Number 1 Region: 2-428
Classification Level Classification E-value
Superfamily ALDH-like 2.23e-129
Family ALDH-like 0.0000000000367
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000010232   Gene: ENSOCUG00000011906   Transcript: ENSOCUT00000011904
Sequence length 485
Comment pep:known_by_projection scaffold:OryCun2.0:GL018817:127097:149114:-1 gene:ENSOCUG00000011906 transcript:ENSOCUT00000011904 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MEREVQRLRRAFRSGRSRPLRFRLQQLEALRRMVQEREADILAAIAADLCKSELNAYSQE
VITILGEIDFMLNNLADWVTAKPVKKNLFTMLDEAYVQAEPLGVVLIIGAWNYPFVLTIQ
PLIGAIAAGNAVILKPSELSEHTAQVLAKLLPQYLDQDLYAVVNGGVKETTELLKERFDH
ILYTGNAAVGRVVMEAAAKHLTPVTLELGGKSPCYIDKDCDLDTVCRRITWGKYMNCGQT
CIAPDYVLCEASLQNHIVQKIKETVQEFYGENIKESPDYERIINLRHFKRIQSLLEGQKI
AFGGETDEATRYIAPTVLTDVDPEAKVMQEEIFGPVLPIVPVKNADEAIQFINEREKPLA
LYIFSHNDKLIRRMIDETSSGGVTGNDVIMHFTLNSLPFGGVGHSGMGAYHGKHTFDTFS
HQRPCLLKSLKGESANKLRYPPNSQSKVDWAKFFLLKQFHKGKLGLLLLAVLGIVAALLV
KTGYY
Download sequence
Identical sequences G1T276
ENSOCUP00000010232 XP_008248572.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]