SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000010257 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000010257
Domain Number 1 Region: 11-133
Classification Level Classification E-value
Superfamily DNA clamp 0.0000000000000123
Family DNA polymerase processivity factor 0.025
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000010257   Gene: ENSOCUG00000011929   Transcript: ENSOCUT00000011930
Sequence length 407
Comment pep:known_by_projection chromosome:OryCun2.0:21:6796512:6836892:1 gene:ENSOCUG00000011929 transcript:ENSOCUT00000011930 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MLKCAMSGGAVRVFGKAIQALSRISDYLWLDPSEKGLALRTLNSSESSYGSVLFSPVFFQ
HYQWSPVKMNDNGTALHLNCKLGMKSILPIFRYPNSLERNVEKCKIFTRSDKCKVVIQFF
CRHGIKRTHNVHFQESMPVQVIFEKNMCTNTLMIQPRLLAEAIVLFTPSQEEVTLAVTPL
NFCLKSPHEESMDLTNSVYSEMFVGPDEFDFFQIGVDTEITFCIKELKGMLIFSEATHAP
ISIHFDFPGKPMALSLDDMLLEANFILATLDDGPSRASSPQSSLCLSQTGGRSDLIQSNS
EASKNVTSQVSENISRIATEKFHPHVTCTHISTLENRGSPVMTGVNADISEVPESIVSDT
EEGPGCSHLRKFSCMFFGALSSDQPEHISHPLDNVATASDSEEDTQN
Download sequence
Identical sequences G1T293
9986.ENSOCUP00000010257 ENSOCUP00000010257 ENSOCUP00000010257

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]