SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000010262 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000010262
Domain Number 1 Region: 438-671
Classification Level Classification E-value
Superfamily HCP-like 2.96e-48
Family HCP-like 0.00017
Further Details:      
 
Domain Number 2 Region: 645-779
Classification Level Classification E-value
Superfamily HCP-like 1.05e-26
Family HCP-like 0.0059
Further Details:      
 
Domain Number 3 Region: 278-402
Classification Level Classification E-value
Superfamily HCP-like 1.31e-24
Family HCP-like 0.003
Further Details:      
 
Domain Number 4 Region: 196-249
Classification Level Classification E-value
Superfamily Kringle-like 8.57e-20
Family Fibronectin type II module 0.00085
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000010262   Gene: ENSOCUG00000011932   Transcript: ENSOCUT00000011935
Sequence length 873
Comment pep:known_by_projection chromosome:OryCun2.0:20:23797821:23858401:1 gene:ENSOCUG00000011932 transcript:ENSOCUT00000011935 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MGDPGRGNEEGGETMAIGPRTRGGARGLAAPWVSEAWEGAEEGDQSRKSLGEAAAAAAES
VVAEVKATAPGGGGGTDSRMRVQVGLTLLLYAALLGPAMVSSDEEGSQDESLDSKSPLPP
DESVKDHNTAGRVVAGQIFLDPEESELESSIQEEEDSLKNQEGESATEEISFLESPNPEN
KDYDEPKKVRKPALTAIEGTAHGEPCHFPFLFLDKEYDECTADGREDGRLWCATTYDYKA
DEKWGFCETEEEATRRRQMQEAEMMYQTGMKILNGSNKKSQKREAYRYLQKAASMNHTKA
LERVSYALLFGDYLTQNIQAAKEMFEKLTEEGSPKGQTALGFLYASGLGVNSSQAKALVY
YTFGALGGNLIAHMVLGYRYWAGIGVLQSCESALTHYRLVANHVASDISLTGGSVVQRIR
LPDEVENPGMNSGMLEEDLIQYYQFLAEKGDVQAQVGLGQLHLHGGRGVEQNHQRAFDYF
NLAANAGNSHAMAFLGKMYSEGSDIVPQSNETALHYFKKAADMGNPVGQSGLGMAYLYGR
GVQVNYDLALKYFQKAAEQGWVDGQLQLGSMYYNGIGVKRDYKQALKYFNLASQGGHILA
FYNLAQMHASGTGVMRSCHTAVELFKNVCERGRWSERLMTAYNSYKDGDYNAAVIQYLLL
AEQGYEVAQSNAAFILDQREATIVGENETYPRALLHWNRAASQGYTVARIKLGDYHFYGF
GTDVDYETAFIHYRLASEQQHSAQAMFNLGYMHEKGLGIKQDIHLAKRFYDMAAEASPDA
QVPVFLALCKLGVVYFLQYIRETNIRDMFTQLDMDQLLGPEWDLYLMTVIALLLGTVIAY
RQRQHQDMPVPRPPGPRPAPPQQEGPPEQPPPQ
Download sequence
Identical sequences G1T297
ENSOCUP00000010262

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]