SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000010462 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000010462
Domain Number 1 Region: 259-437
Classification Level Classification E-value
Superfamily ITPase-like 1.35e-30
Family YjjX-like 0.0034
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000010462   Gene: ENSOCUG00000012160   Transcript: ENSOCUT00000012160
Sequence length 445
Comment pep:novel chromosome:OryCun2.0:3:11199865:11225706:1 gene:ENSOCUG00000012160 transcript:ENSOCUT00000012160 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MMEESGIETTPPGTPPPNPAGLVTTAVSPSPVPLAATSSFPSANVSTLESLPPHAYSTPQ
PSLAPVRPSAPLPFVPPSPVPSVPPLGTSVPPPVSSAPAAAFSHAPPFHFPPSASAPSAL
LPAPAPGPPTSGFSVGATYDITRGHAGRAPQTPLMPSFSAPPVTGILPTPITQQASLTSV
AQGTGTTSAITFPEEQEDPRISQGQDEASAGGIWGFIKGVAGNPMVKSVLDKTKHSVESM
ITTLDPGMAPYIKSGGELDIVVTSNKEVKVAAVRDAFQEVFGLAVVVGEAGQSNIAPQPV
GYAAGLKGAQERIDSLRRTGVIHEKQTAVSVENFIAELLPDKWFDIGCLVVEDPVHGIHL
EAFTQATPVPLEFVQQAQSLTPQDYNLRWSGLLVTVGEVLEKSLLSVSRTDWHMAFTGVS
RRQMIYSAAKAVAGMYKQRLPPRTV
Download sequence
Identical sequences G1T2Q8
ENSOCUP00000010462 ENSOCUP00000010462 XP_002710227.1.1745 9986.ENSOCUP00000010462

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]