SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000010920 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000010920
Domain Number 1 Region: 2-54
Classification Level Classification E-value
Superfamily LEM domain 6.15e-23
Family LEM domain 0.000057
Further Details:      
 
Domain Number 2 Region: 110-157
Classification Level Classification E-value
Superfamily LEM domain 0.00000000000000327
Family LEM domain 0.0000899
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score
Cellular Component IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000010920   Gene: ENSOCUG00000012692   Transcript: ENSOCUT00000012686
Sequence length 385
Comment pep:known_by_projection chromosome:OryCun2.0:4:77817894:77849575:1 gene:ENSOCUG00000012692 transcript:ENSOCUT00000012686 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MPEFLEDPSVLTKDKLKSELVANNVTLPAGEQRKDVYVQLYLQHLTARNRPPLAAGSNSK
GPPDFSSDEEREPTPVLGSVAAAAAAGRSRASVGRKATKKTDKPRLDDKDDLDVTELTNE
DLLEQLVKYGVNPGPIVGTTRKLYEKKLLKLREQGTESRSSTPLPTISSSAENTRQNGSN
DSDRYSDNEEDSKIELKLEKREPLKGRAKTPVTLKQRRIEHNQVVNRVTGNFKHATPILP
ITEFSDIPRRTPKKPLTRAEVGEKTEDRRVERDILKEMFPYEAATPTGISASCRRPIKGA
AGRPLELSDFRMEESFSSKYVPKYVPLADVKSEKTKKKGRSIPMWIKILLFVIVAVFLFL
VYQAMETNQGNPFSSFLLDDSRKLK
Download sequence
Identical sequences G1T3V5
ENSOCUP00000010920 XP_008255154.1.1745

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]