SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000010990 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000010990
Domain Number 1 Region: 210-348
Classification Level Classification E-value
Superfamily C-type lectin-like 8.44e-34
Family C-type lectin domain 0.00081
Further Details:      
 
Domain Number 2 Region: 348-488
Classification Level Classification E-value
Superfamily C-type lectin-like 1.12e-31
Family C-type lectin domain 0.00046
Further Details:      
 
Domain Number 3 Region: 1375-1518
Classification Level Classification E-value
Superfamily C-type lectin-like 1.59e-27
Family C-type lectin domain 0.0025
Further Details:      
 
Domain Number 4 Region: 1538-1668
Classification Level Classification E-value
Superfamily C-type lectin-like 1.56e-26
Family C-type lectin domain 0.00069
Further Details:      
 
Domain Number 5 Region: 33-155
Classification Level Classification E-value
Superfamily Ricin B-like lectins 1.3e-25
Family Cysteine rich domain 0.0044
Further Details:      
 
Domain Number 6 Region: 636-792
Classification Level Classification E-value
Superfamily C-type lectin-like 3.88e-25
Family C-type lectin domain 0.0014
Further Details:      
 
Domain Number 7 Region: 499-625
Classification Level Classification E-value
Superfamily C-type lectin-like 9.1e-20
Family C-type lectin domain 0.0021
Further Details:      
 
Domain Number 8 Region: 1243-1362
Classification Level Classification E-value
Superfamily C-type lectin-like 3.85e-17
Family C-type lectin domain 0.0067
Further Details:      
 
Domain Number 9 Region: 154-210
Classification Level Classification E-value
Superfamily Kringle-like 6.85e-16
Family Fibronectin type II module 0.0023
Further Details:      
 
Domain Number 10 Region: 945-1039
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000000000332
Family C-type lectin domain 0.0064
Further Details:      
 
Domain Number 11 Region: 818-931
Classification Level Classification E-value
Superfamily C-type lectin-like 0.00000000000012
Family C-type lectin domain 0.014
Further Details:      
 
Domain Number 12 Region: 1126-1227
Classification Level Classification E-value
Superfamily C-type lectin-like 0.0000000000927
Family C-type lectin domain 0.0028
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Biological Process IC (bits) H-Score
Molecular Function IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000010990   Gene: ENSOCUG00000012761   Transcript: ENSOCUT00000012772
Sequence length 1727
Comment pep:novel chromosome:OryCun2.0:7:98696941:98792842:-1 gene:ENSOCUG00000012761 transcript:ENSOCUT00000012772 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
MRTRWATPRCAAGLLALLLPCLGLAEPIGRAGNEPFTIVNENTGKCLKVLDDWIVAKDCN
ETEDVLWKWVSQHRLFHLESQKCLGLDITKPTYSLKMFSCDSQAMLWWKCEHRHLYGAAQ
YRLAVKDGYAIASTNVSDVWKKGGSEEGLCDQPYREIYTRDGNSFGRPCEFPFLVDGKWH
HECIVSKNHSGPWCATTLNYEYDQKWGICLKPENGCENNWEKNEKLGSCYQFNTQETLSW
KEAYVSCHNQGADLLSINNAAELTYLKEKEDIARVFWIGLNQLYSARGWEWSDHKPLNFL
NWDPDKPSAPTLGGSSCVKMDAESGLWQSYSCEVLLPYVCKKPLNNTTELTDVWTYSDTR
CDADWLPNNGFCYLLVNESDSWDNASTECKASGSDLLSIHSLADVEVVVTKLHHGDAKEE
IWTGLKNINMPTLFQWSDGSDVTLTYWDENEPNVPYNKTPNCVSYLGKLGQWKVQSCEKK
LKYVCKKKGEKINDPKSDKLCPPDEGWKRHGEACYKIYSDEVPFGKNCNLTITSSFEQEF
LNDMMKKYDKSLTKYFWTGLTDVDSRGEYSWATVGGIKQAVTFSNWNFLEPASPGGCVAM
STGKSLGKWEVKDCRNFRALSICKKMSGPVEPEQIAPKPSDPCPDGWHSLTSSLSCYKVF
HIERVVRKRNWEEAERFCQALGAHLASFSHMDEITEFLHLLMDQFSDHRWLWVGLNKRSP
DLEGSWQWSDRTPVSTVIMEYEFQQDYDIRDCAAVKVNQRPWRRRWYFYEEREFVYFRPF
ACDTKLEWVCQIPKGHTPKTPEWYNPERAGIHGLPLIVEESEYWFVAEPHLNFEEAFLYC
ASNHSVLATITSFTGLRAIRNRIANISGDEQKWWVRTDERLIDHPFSLSHHRWHYFPMFW
EECLYMSAKTWLMDLNKPADCNTKLPFICEKYSVSSLETYSPDPTAKIQCSEKWIPFGNK
CFLKITPQFLTFSQKSKFVCRSCGGLTYNLKNLLLTDFITSLLPDMKSTLWIGLRWTSQE
RINKWTDNKQLTYSNFHPLLVGRRLQIPANVLHGGIRFHCNYFITLSKNPFKKATFNCYT
ILSEERLMSLCCHFIKVRSRILIETKILKKKEYKNAGKITSPKNETWYSAGRDSCILMPF
SFLVSNNQQFQLCVMTVNAMKSVLSIKLNPFQDELNFGWSDGKHLHFSRWAENNHQLEDC
VMLDKDGFWKTADCEDSQPGAICYYPGNETKKEVKPVDSVKCPSPALNTPWIPFQNCCYN
FMITKNRHMAITQDEVHFKCQQLNPKSQMLSIRDEKENNFVLEQLLHYNYMASWVLLGIT
YENNSLTWFDKTTLSYTHWRAGRPAVKNDKFLAGLSTDGFWDIQTFNVIEEALYFYQHSI
LACKIEMVDYKEEFNTTLPQFIPYKDDIYSVIQKKVTWYEALNACSQSGGQLASVHDQNG
QLFLEDIVKRDGFPLWVGLSSHDGSESSFEWSDGSAFDYIPWKGQKAPGDCVVVDPKGIW
KHEKCSSVKDGAICYKPTKSKELSSYTYSPRCPVAKENASQWIQYKGHCYTSDQALHSFS
EAKQLCSELADHSATIVTIEDEEENKFVSRLMRENNNITMRVWLGLSQSSADQSWNWLDG
SEVTFVKWENKSNSDGGKCSILLASNETWKKVECSHGYGRVVCQVPLTGPDYRGIAITFA
VLGVLVLVSGLIWFLFLRNRFHWRGFSSVRYEQGMNEEEIVLPSFHD
Download sequence
Identical sequences G1T418
ENSOCUP00000010990 ENSOCUP00000010990 9986.ENSOCUP00000010990

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]