SUPERFAMILY 1.75 HMM library and genome assignments server

Superfamily is undergoing a server migration - you are now browsing on the new server. Please contact us if you experience any problems.

Domain assignment for ENSOCUP00000011078 from Oryctolagus cuniculus 76_2

Domain architecture


Domain assignment details

(
show help)
Strong hits

Sequence:  ENSOCUP00000011078
Domain Number 1 Region: 412-522,635-785
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like II 8.47e-55
Family Phosphate binding protein-like 0.0000101
Further Details:      
 
Domain Number 2 Region: 14-398
Classification Level Classification E-value
Superfamily Periplasmic binding protein-like I 8.63e-32
Family L-arabinose binding protein-like 0.0058
Further Details:      
 

Gene Ontology term assignment details

The top 10 most specific Gene Ontology terms for each namespace assigned to this domain architecture as determined by dcGO Predictor

(show help)

Cellular Component IC (bits) H-Score
Molecular Function IC (bits) H-Score
Biological Process IC (bits) H-Score

Protein sequence

External link(s) Protein: ENSOCUP00000011078   Gene: ENSOCUG00000012865   Transcript: ENSOCUT00000012871
Sequence length 983
Comment pep:known_by_projection chromosome:OryCun2.0:18:7461182:8191287:-1 gene:ENSOCUG00000012865 transcript:ENSOCUT00000012871 gene_biotype:protein_coding transcript_biotype:protein_coding
Sequence
GAIFEENAAKDDRVFQLAVSDLSLNDDILQSEKITYSIKVIEANNPFQAVQEACDLMTQG
ILALVTSTGCASANALQSLTDAMHIPHLFVQRNPSGSPRTACQLNPSPEGEAYTLASRPP
VRLNDVMLRLVTELRWQKFVMFYDSEYDIRGLQSFLDQASRLGLDVSLQKVDKNVSHVFS
SLFTTMKTEELNRYRDTLRRAILLLSPRGPFSLSLQAVETNLASKDSHWVFVNEEISDPE
ILDLVHSALGRMTVVRQIFPSAKDNQKCMRNNHRISSLLCDPQEGYLQMLQISNLYLYDS
VLMLANAFHRKLEDRKWHSMASLNCIRKSTKPWNGGRSMLDTIKKGHITGLTGVMEFRED
SSNPYVQFEILGTTYSETFGKDMRKLATWDSEKGLNGSLQERPMGSRLQGLTLKVVTVLE
EPFVMVAENILGQPKRYKGFSIDVLDALAKALGFKYEIYQAPNGRYGHQLHNASWNGMIG
ELISKRADVAISAITITPERESVVDFSKRYMDYSVGILMKKPEEKISIFSLFVPFDFAVW
ACIAAAIPVVGVLIFVLNLIQAVRAQSATQPRPSASATLHSAIWIVYGAFVQQGGESSVN
SMAMRIVMGSWWLFTLIVCSSYTANLAAFLTVSRMTTPFRTFQDLSKQVEMSYGTVRDSA
VYEYFRAKGTNLLEQDSTFAELWRTISKNGGADNCVASPSEGIRKAKKGNYAFLWDVAVV
EYAALTDDECSVTVIGNSISSKGYGIALQHGSPYRDLFSQRILELQDTGDLDVLKQKWWP
HTGRCDLTSHTSAQADGKSLKLHSFAGVFCILAIGLLLACLVAALELWWNSNRCHQESPK
EDKEVNLEQVHRRMNSLMDEDIAHKQISPASIELSALEMGGLAPSQALEPTREYQNTQLS
VSTFLPEQSSHGTSRTLSTGPSSSLPLPLSTAATMPSMQCKHRSPNGGLFRQSPVKTPIP
MSFQPVPGGVLPEALDTSHGTSI
Download sequence
Identical sequences G1T490
ENSOCUP00000011078 9986.ENSOCUP00000011078 ENSOCUP00000020642

Jump to [ Top of page · Domain architecture · Domain assignment details · Most Informative Gene Ontologies ]